Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYNLL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DYNLL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05963A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYNLL2 |
| Target Synonyms | Dlc2; DNCL1B; RSPH22; DYNLL2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | Uniprot ID | Q96FJ2 |
Uniprot Id
Q96FJ2
Target Species
Human
Target Name
DYNLL2
Target Full Name
Dynein light chain 2, cytoplasmic
Target Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Dynein light chain family
Target Synonyms
8 kDa dynein light chain b; C87222; cytoplasmic; Dlc2; DLC8b; DNCL1B; DYL2_HUMAN; Dynein light chain 2; Dynein light chain 2; cytoplasmic; Dynein light chain LC8 type 2; Dynein light chain LC8-type 2; Dynll2; MGC17810; MGC72334
Target Background
Predicted to enable dynein intermediate chain binding activity and dynein light intermediate chain binding activity. Predicted to be involved in cilium assembly. Located in 9+0 non-motile cilium and centrosome. Is active in glutamatergic synapse and postsynapse.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
