-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYNLRB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DYNLRB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11917A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYNLRB1 |
| Target Synonyms | BLP; BITH; DNCL2A; DNLC2A; ROBLD1; DYNLRB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE | Uniprot ID | Q9NP97 |
Uniprot Id
Q9NP97
Target Species
Human
Target Name
DYNLRB1
Target Full Name
Dynein light chain roadblock-type 1
Target Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
GAMAD family
Target Tissue Specificity
High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
Target Research Area
Cancer
Target Synonyms
DYNLRB1; BITH; DNCL2A; DNLC2A; ROBLD1; HSPC162Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A; cytoplasmic; Dynein-associated protein Km23; Roadblock domain-containing protein 1
Target Background
This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18.
Notification