-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYNLT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 9-99 of human DYNLT3 (NP_006511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DYNLT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 9-99 of human DYNLT3 (NP_006511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04184A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYNLT3 |
| Target Synonyms | RP3; TCTE1L; TCTEX1L; DYNLT3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 9-99 of human DYNLT3 (NP_006511.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE | Uniprot ID | P51808 |
Uniprot Id
P51808
Target Species
Human
Target Name
DYNLT3
Target Full Name
Dynein light chain Tctex-type 3
Target Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore. Note=Colocalizes with BUB3 at kinetochores specifically during prometaphase.
Target Protein Families
Dynein light chain Tctex-type family
Target Synonyms
DYNLT3; TCTE1L; TCTE1XLDynein light chain Tctex-type 3; Protein 91/23; T-complex-associated testis-expressed 1-like
Target Background
This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.
Notification