-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYRK1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DYRK1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12378A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYRK1A |
| Target Synonyms | MNB; DYRK; HP86; MNBH; MRD7; DYRK1; DYRK1A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS | Uniprot ID | Q13627 |
Uniprot Id
Q13627
Target Species
Human
Target Name
DYRK1A
Target Full Name
Dual specificity tyrosine-phosphorylation-regulated kinase 1A
Target Function
Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6. Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis.
Target Involvement
Mental retardation, autosomal dominant 7 (MRD7)
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MNB/DYRK subfamily
Target Tissue Specificity
Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
Target Synonyms
Dual specificity tyrosine phosphorylation regulated kinase; Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A; Dual specificity tyrosine phosphorylation regulated kinase 1; Dual specificity tyrosine phosphorylation regulated kinase 1A; Dual specificity tyrosine-phosphorylation-regulated kinase 1A; Dual specificity YAK 1 related kinase; Dual specificity YAK1 related kinase; Dual specificity YAK1-related kinase; DYR1A_HUMAN; DYRK 1; DYRK 1A; DYRK; DYRK1; Dyrk1a; DYRKA; hMNB; HP 86; HP86; Minibrain (Drosophila) homolog; Minibrain homolog; Minibrain; Drosophila; homolog of; MNB; MNB protein kinase; Mnb protein kinase homolog hp86; MNB protein kinase; Serine/threonine-specific; MNB/DYRK protein kinase; MNBH; MRD7; OTTHUMP00000109090; OTTHUMP00000109091; OTTHUMP00000109094; OTTHUMP00000174799; Protein kinase minibrain homolog; Serine/threonine kinase MNB
Target Background
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.
Notification