-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against E2F1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against E2F1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-16999A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | E2F1 |
| Target Synonyms | RBP3; E2F-1; RBAP1; RBBP3; E2F1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, HT-29, Mouse brain, Mouse testis, Rat spleen, Rat thymus, U-87MG | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF | Uniprot ID | Q01094 |
Uniprot Id
Q01094
Target Species
Human
Target Name
E2F1
Target Full Name
Transcription factor E2F1
Target Function
Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F1 binds preferentially RB1 in a cell-cycle dependent manner. It can mediate both cell proliferation and TP53/p53-dependent apoptosis. Blocks adipocyte differentiation by binding to specific promoters repressing CEBPA binding to its target gene promoters. Positively regulates transcription of RRP1B.
Target Subcellular Location
Nucleus.
Target Protein Families
E2F/DP family
Target Research Area
Others
Target Synonyms
RBP3; E2F-1; RBAP1; RBBP3; E2F1
Target Background
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.
Notification