-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against E2F3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human E2F3 (NP_001230005.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against E2F3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human E2F3 (NP_001230005.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12061A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | E2F3 |
| Target Synonyms | E2F-3; E2F3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human E2F3 (NP_001230005.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ | Uniprot ID | O00716 |
Uniprot Id
O00716
Target Species
Human
Target Name
E2F3
Target Full Name
Transcription factor E2F3
Target Function
Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters.
Target Subcellular Location
Nucleus.
Target Protein Families
E2F/DP family
Target Synonyms
DKFZp686C18211; E2F 3; E2F transcription factor 3; E2F-3; E2F3; E2F3_HUMAN; KIAA0075; MGC104598; Transcription factor E2F 3; Transcription factor E2F3
Target Background
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants.
Notification