Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human EAF2 (NP_060926.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human EAF2 (NP_060926.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02671A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EAF2 |
| Target Synonyms | U19; BM040; TRAITS; EAF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Mouse spleen, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human EAF2 (NP_060926.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLM | Uniprot ID | Q96CJ1 |
Uniprot Id
Q96CJ1
Target Species
Human
Target Name
EAF2
Target Full Name
ELL-associated factor 2
Target Function
Acts as a transcriptional transactivator of TCEA1 elongation activity. Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.
Target Subcellular Location
Nucleus speckle.
Target Protein Families
EAF family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes.
Target Synonyms
BM 040; BM040; EAF 2; EAF2; EAF2_HUMAN; Ehrlich S II transcriptional activator factor ; ELL associated factor 2; ELL-associated factor 2; Festa; Testosterone regulated apoptosis inducer and tumor suppressor; Testosterone regulated apoptosis inducer and tumor suppressor protein; Testosterone-regulated apoptosis inducer and tumor suppressor protein; TRAITS; U19; Uncharacterized bone marrow protein BM 040; Uncharacterized bone marrow protein BM040
Target Background
Enables transcription elongation regulator activity. Involved in positive regulation of transcription by RNA polymerase II and regulation of transcription elongation from RNA polymerase II promoter. Part of transcription elongation factor complex. Biomarker of prostate cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
