-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EBAG9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-213 of human EBAG9 (NP_004206.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EBAG9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-213 of human EBAG9 (NP_004206.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09934A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EBAG9 |
| Target Synonyms | EB9; PDAF; EBAG9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-213 of human EBAG9 (NP_004206.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS | Uniprot ID | O00559 |
Uniprot Id
O00559
Target Species
Human
Target Name
EBAG9
Target Full Name
Receptor-binding cancer antigen expressed on SiSo cells
Target Function
May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type III membrane protein. Note=According to PubMed:10426319, it also exists as a soluble form which has the same biological activities. The existence of such soluble form is however uncertain.
Target Tissue Specificity
Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.
Target Research Area
Apoptosis
Target Synonyms
BAG9; Cancer associated surface antigen; Cancer associated surface antigen RCAS1; Cancer-associated surface antigen RCAS1; EB9; EBAG 9; EBAG9; Estrogen receptor binding fragment associated gene 9 protein; Estrogen receptor binding site associated antigen 9; estrogen receptor binding site associated; antigen; 9; Estrogen receptor-binding fragment-associated gene 9 protein; PDAF; RCAS 1; RCAS1; RCAS1_HUMAN; Receptor binding cancer antigen expressed on SiSo cells; Receptor-binding cancer antigen expressed on SiSo cells
Target Background
This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10.
Notification