Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EBF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EBF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04703A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EBF3 |
| Target Synonyms | COE3; OE-2; EBF-3; HADDS; O/E-2; EBF3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF | Uniprot ID | Q9H4W6 |
Uniprot Id
Q9H4W6
Target Species
Human
Target Name
EBF3
Target Full Name
Transcription factor COE3
Target Function
Transcriptional activator. Recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.
Target Involvement
Hypotonia, ataxia, and delayed development syndrome (HADDS)
Target Subcellular Location
Nucleus.
Target Protein Families
COE family
Target Tissue Specificity
Expressed in brain.
Target Synonyms
COE 3; COE3; COE3_HUMAN; Early B cell factor 3; Early B-cell factor 3; EBF 3; EBF-3; EBF3; O/E 2; O/E-2; O/E2; OE 2; OE-2; OE2; Olf 1/EBF like 2; Olf-1/EBF-like 2; Transcription factor COE3
Target Background
This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
