-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EDAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EDAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08790A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDAR |
| Target Synonyms | DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R; EDAR | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATA | Uniprot ID | Q9UNE0 |
Uniprot Id
Q9UNE0
Target Species
Human
Target Name
EDAR
Target Full Name
Tumor necrosis factor receptor superfamily member EDAR
Target Function
Receptor for EDA isoform A1, but not for EDA isoform A2. Mediates the activation of NF-kappa-B and JNK. May promote caspase-independent cell death.
Target Involvement
Ectodermal dysplasia 10A, hypohidrotic/hair/nail type, autosomal dominant (ECTD10A); Ectodermal dysplasia 10B, hypohidrotic/hair/tooth type, autosomal recessive (ECTD10B)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in fetal kidney, lung, skin and cultured neonatal epidermal keratinocytes. Not detected in lymphoblast and fibroblast cell lines.
Target Synonyms
Anhidrotic ectodysplasin receptor 1; DL; Downless (mouse) homolog; Downless homolog; Downless mouse homolog of; ECTD10A; ECTD10B; Ectodermal dysplasia receptor; Ectodysplasin 1 anhidrotic receptor; Ectodysplasin A receptor; Ectodysplasin A1 isoform receptor; Ectodysplasin-A receptor; ED 1R; ED 3; ED 5; ED1R; ED3; ED5; EDA 1R; EDA 3; EDA A1 receptor; EDA A1R; EDA-A1 receptor; EDA1R; EDA3; Edar; EDAR_HUMAN; HRM1; Tumor necrosis factor receptor superfamily member EDAR
Target Background
This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.
Notification