Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EEA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEA1 (Q15075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EEA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEA1 (Q15075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13933A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EEA1 |
| Target Synonyms | MST105; ZFYVE2; MSTP105; EEA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEA1 (Q15075). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLK | Uniprot ID | Q15075 |
Uniprot Id
Q15075
Target Species
Human
Target Name
EEA1
Target Full Name
Early endosome antigen 1
Target Function
Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in endosomal trafficking.
Target Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein.
Target Synonyms
Early endosome antigen 1; Early endosome antigen 1; 162kD; Early endosome associated protein; EEA 1; EEA1; EEA1_HUMAN; Endosome associated protein p162; Endosome-associated protein p162; MST105; MSTP105; ZFYVE2; Zinc finger FYVE domain containing protein 2; Zinc finger FYVE domain-containing protein 2
Target Background
Enables 1-phosphatidylinositol binding activity; GTP-dependent protein binding activity; and protein homodimerization activity. Involved in endocytosis; vesicle fusion; and viral RNA genome replication. Located in cytosol and early endosome. Is extrinsic component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
