-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EFNB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 259-346 of human EFNB1 (NP_004420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EFNB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 259-346 of human EFNB1 (NP_004420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05570A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EFNB1 |
| Target Synonyms | CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2; EFNB1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 259-346 of human EFNB1 (NP_004420.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV | Uniprot ID | P98172 |
Uniprot Id
P98172
Target Species
Human
Target Name
EFNB1
Target Full Name
Ephrin-B1
Target Function
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binding to Eph receptors residing on adjacent cells leads to contact-dependent bidirectional signaling into neighboring cells. Shows high affinity for the receptor tyrosine kinase EPHB1/ELK. Can also bind EPHB2 and EPHB3. Binds to, and induces collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
Target Involvement
Craniofrontonasal syndrome (CFNS)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Ephrin-B1 C-terminal fragment]: Cell membrane; Single-pass type I membrane protein.; [Ephrin-B1 intracellular domain]: Nucleus.
Target Protein Families
Ephrin family
Target Tissue Specificity
Widely expressed. Detected in both neuronal and non-neuronal tissues. Seems to have particularly strong expression in retina, sciatic nerve, heart and spinal cord.
Target Synonyms
EFNB1; EFL3; EPLG2; LERK2; Ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2
Target Background
The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Notification