-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA, DB.
The antibody against EGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA, DB.
| Cat.No | ADA-04283A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | egf |
| Target Synonyms | URG; HOMG4; EGF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T | Application | ELISA, WB, DB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR | Uniprot ID | P01133 |
Uniprot Id
P01133
Target Species
Human
Target Name
EGF
Target Full Name
Pro-epidermal growth factor
Target Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro.
Target Involvement
Hypomagnesemia 4 (HOMG4)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in kidney, salivary gland, cerebrum and prostate.
Target Research Area
Cancer Signal Transduction
Target Synonyms
Beta urogastrone; beta-urogastrone; EGF; EGF_HUMAN; Epidermal growth factor; HOMG4; OTTHUMP00000219721; OTTHUMP00000219722; Pro epidermal growth factor; URG; Urogastrone
Target Background
This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Notification