Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGLN1/EGLN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EGLN1/EGLN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01440A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGLN1/EGLN2 |
| Target Synonyms | EGLN1/EGLN2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK | Uniprot ID | Q9GZT9, Q96KS0 |
Uniprot Id
Q9GZT9, Q96KS0
Target Synonyms
EGLN1/EGLN2
Target Background
The proteins encoded by EGLN1/EGLN2 gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
