Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-589 of human EGR4 (NP_001956.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EGR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-589 of human EGR4 (NP_001956.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09838A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGR4 |
| Target Synonyms | AT133; NGFIC; NGFI-C; PAT133; EGR4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 440-589 of human EGR4 (NP_001956.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL | Uniprot ID | Q05215 |
Uniprot Id
Q05215
Target Species
Human
Target Name
EGR4
Target Full Name
Early growth response protein 4
Target Function
Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCGGGGGCG-3' (GSG). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Target Subcellular Location
Nucleus.
Target Protein Families
EGR C2H2-type zinc-finger protein family
Target Synonyms
NGFIC; NGF1-C; NGFI-C; pAT133; Egr4
Target Background
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; and tooth. Orthologous to human EGR4 (early growth response 4).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
