Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against eIF1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13320A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eIF1A |
| Target Synonyms | EIF1A; EIF4C; eIF-1A; eIF-4C; EIF1AP1; eIF1A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse liver, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI | Uniprot ID | P47813 |
Uniprot Id
P47813
Target Species
Human
Target Name
EIF1AX
Target Full Name
Eukaryotic translation initiation factor 1A, X-chromosomal
Target Function
Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
Target Protein Families
EIF-1A family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EIF1AX; EIF1A; EIF4C; Eukaryotic translation initiation factor 1A; X-chromosomal; eIF-1A X isoform; Eukaryotic translation initiation factor 4C; eIF-4C
Target Background
This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
