Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF1AX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-144 of human EIF1AX (NP_001403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against EIF1AX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-144 of human EIF1AX (NP_001403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09626A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF1AX |
| Target Synonyms | EIF1A; EIF4C; eIF-1A; eIF-4C; EIF1AP1; EIF1AX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, MCF7, Mouse brain, NCI-H460, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-144 of human EIF1AX (NP_001403.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI | Uniprot ID | P47813 |
Uniprot Id
P47813
Target Species
Human
Target Name
EIF1AX
Target Full Name
Eukaryotic translation initiation factor 1A, X-chromosomal
Target Function
Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
Target Protein Families
EIF-1A family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EIF1AX; EIF1A; EIF4C; Eukaryotic translation initiation factor 1A; X-chromosomal; eIF-1A X isoform; Eukaryotic translation initiation factor 4C; eIF-4C
Target Background
This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
