Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF2B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human EIF2B4 (Q9UI10) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EIF2B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human EIF2B4 (Q9UI10) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06704A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF2B4 |
| Target Synonyms | EIF2B; EIF-2B; EIF2Bdelta; EIF2B4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human EIF2B4 (Q9UI10). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAEL | Uniprot ID | Q9UI10 |
Uniprot Id
Q9UI10
Target Species
Human
Target Name
EIF2B4
Target Full Name
Translation initiation factor eIF2B subunit delta
Target Function
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Target Involvement
Leukodystrophy with vanishing white matter (VWM)
Target Protein Families
EIF-2B alpha/beta/delta subunits family
Target Synonyms
EI2BD_HUMAN; EIF 2B; eIF 2B GDP GTP exchange factor subunit delta; eIF-2B GDP-GTP exchange factor subunit delta; Eif2b4; EIF2Bdelta; eukaryotic translation initiation factor 2B subunit 4; Translation initiation factor eIF-2B subunit delta
Target Background
Eukaryotic initiation factor 2B (EIF2B), which is necessary for protein synthesis, is a GTP exchange factor composed of five different subunits. The protein encoded by this gene is the fourth, or delta, subunit. Defects in this gene are a cause of leukoencephalopathy with vanishing white matter (VWM) and ovarioleukodystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
