-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF2C3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against eIF2C3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14287A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eIF2C3 |
| Target Synonyms | EIF2C3; Argonaute3; hAgo3; eIF2C3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, C2C12, Mouse brain, Mouse lung, Rat lung, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA | Uniprot ID | Q9H9G7 |
Uniprot Id
Q9H9G7
Target Species
Human
Target Name
AGO3
Target Full Name
Protein argonaute-3
Target Function
Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Proposed to be involved in stabilization of small RNA derivates (siRNA) derived from processed RNA polymerase III-transcribed Alu repeats containing a DR2 retinoic acid response element (RARE) in stem cells and in the subsequent siRNA-dependent degradation of a subset of RNA polymerase II-transcribed coding mRNAs by recruiting a mRNA decapping complex involving EDC4. Possesses RNA slicer activity but only on select RNAs bearing 5'- and 3'-flanking sequences to the region of guide-target complementarity.
Target Subcellular Location
Cytoplasm, P-body.
Target Protein Families
Argonaute family, Ago subfamily
Target Synonyms
5730550L01Rik; Ago 3; Ago3; AGO3_HUMAN; argonaute 3; Argonaute3; eIF 2C 3; eIF-2C 3; eIF2C 3; Eif2c3; EIF2C3 protein; Eukaryotic translation initiation factor 2C 3; Eukaryotic translation initiation factor 2C3; FLJ12765; hAgo3; MGC86946; Protein argonaute-3
Target Background
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene.
Notification