-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF2S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human EIF2S2 (NP_003899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF2S2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human EIF2S2 (NP_003899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04531A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF2S2 |
| Target Synonyms | EIF2; EIF2B; PPP1R67; EIF2beta; eIF-2-beta; EIF2S2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, LO2, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human EIF2S2 (NP_003899.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT | Uniprot ID | P20042 |
Uniprot Id
P20042
Target Species
Human
Target Name
EIF2S2
Target Full Name
Eukaryotic translation initiation factor 2 subunit 2
Target Function
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
Target Protein Families
EIF-2-beta/eIF-5 family
Target Synonyms
DKFZp686L18198; eIF 2 beta; eIF-2-beta; EIF2; EIF2B; EIF2beta; EIF2S2; Eukaryotic initiation factor 2 beta; eukaryotic initiation factor 2-beta; Eukaryotic translation initiation factor 2 beta; Eukaryotic translation initiation factor 2 subunit 2; Eukaryotic translation initiation factor 2 subunit 2 beta 38kDa; Eukaryotic translation initiation factor 2 subunit 2 beta; Eukaryotic translation initiation factor 2 subunit beta; eukaryotic translation initiation factor 2; subunit 2 beta; 38kDa; IF2B_HUMAN; MGC8508; PPP1R67; protein phosphatase 1; regulatory subunit 67
Target Background
Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification