-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human eIF3B (NP_003742.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against eIF3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human eIF3B (NP_003742.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16130A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eIF3B |
| Target Synonyms | PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116; eIF3B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human eIF3B (NP_003742.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRL | Uniprot ID | P55884 |
Uniprot Id
P55884
Target Species
Human
Target Name
EIF3B
Target Full Name
Eukaryotic translation initiation factor 3 subunit B
Target Function
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.; (Microbial infection) In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2
Target Subcellular Location
Cytoplasm.
Target Protein Families
EIF-3 subunit B family
Target Synonyms
eIF-3-eta; eIF3 eta; eIF3 p110; eIF3 p116; EIF3-ETA; EIF3-P110; EIF3-P116; eIF3b; EIF3B_HUMAN; EIF3S9; EIF3S9; formerly; Eukaryotic translation initiation factor 3; subunit B; Eukaryotic translation initiation factor 3 subunit 9; eukaryotic translation initiation factor 3 subunit 9 eta; Eukaryotic translation initiation factor 3 subunit B; eukaryotic translation initiation factor 3; subunit 9 (eta; 116kD); eukaryotic translation initiation factor 3; subunit 9 eta; 116kDa; eukaryotic translation initiation factor 3; subunit 9; formerly; hPrt1; Protein synthesis defective at 36 degrees celsius 1; S. cerevisiae; homolog of; PRT1; Prt1 homolog
Notification