Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4E3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human EIF4E3 (NP_775495.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF4E3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human EIF4E3 (NP_775495.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00687A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4E3 |
| Target Synonyms | eIF-4E3; eIF4E-3; EIF4E3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human EIF4E3 (NP_775495.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH | Uniprot ID | Q8N5X7 |
Uniprot Id
Q8N5X7
Target Species
Human
Target Name
EIF4E3
Target Full Name
Eukaryotic translation initiation factor 4E type 3
Target Function
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. May act as an inhibitor of EIF4E1 activity.
Target Protein Families
Eukaryotic initiation factor 4E family
Target Synonyms
EIF4E3Eukaryotic translation initiation factor 4E type 3; eIF-4E type 3; eIF-4E3; eIF4E type 3; eIF4E-3
Target Background
EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome (Joshi et al., 2004 [PubMed 15153109]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
