-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF4EBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (Q13541) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eIF4EBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (Q13541) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17023A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4EBP1 |
| Target Synonyms | BP-1; 4EBP1; 4E-BP1; PHAS-I; eIF4EBP1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (Q13541). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN | Uniprot ID | Q13541 |
Uniprot Id
Q13541
Target Species
Human
Target Name
EIF4EBP1
Target Full Name
Eukaryotic translation initiation factor 4E-binding protein 1
Target Function
Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
Target Protein Families
EIF4E-binding protein family
Target Synonyms
4E-BP1; 4EBP1; 4EBP1_HUMAN; BP 1; eIF4E binding protein 1; eIF4E-binding protein 1; Eif4ebp1; Eukaryotic translation initiation factor 4E-binding protein 1; PHAS-I; PHASI; Phosphorylated heat- and acid-stable protein regulated by insulin 1
Target Background
This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.
Notification