-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4EBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-120 of human EIF4EBP2 (NP_004087.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF4EBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-120 of human EIF4EBP2 (NP_004087.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4EBP2 |
| Target Synonyms | 4EBP2; PHASII; EIF4EBP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-120 of human EIF4EBP2 (NP_004087.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI | Uniprot ID | Q13542 |
Uniprot Id
Q13542
Target Species
Human
Target Name
EIF4EBP2
Target Full Name
Eukaryotic translation initiation factor 4E-binding protein 2
Target Function
Repressor of translation initiation involved in synaptic plasticity, learning and memory formation. Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
Target Protein Families
EIF4E-binding protein family
Target Research Area
Transcription
Target Synonyms
4E-BP2; 4EBP2; 4EBP2_HUMAN; eIF4E binding protein 2; eIF4E-binding protein 2; Eif4ebp2; Eukaryotic translation initiation factor 4E binding protein 1; Eukaryotic translation initiation factor 4E-binding protein 2; PHASII; phosphorylated; heat and acid stable regulated by insulin protein II
Target Background
This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
Notification