Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4ENIF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human EIF4ENIF1 (NP_001157973.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EIF4ENIF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human EIF4ENIF1 (NP_001157973.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10130A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4ENIF1 |
| Target Synonyms | 4E-T; Clast4; EIF4ENIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, LO2, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EIF4ENIF1 (NP_001157973.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR | Uniprot ID | Q9NRA8 |
Uniprot Id
Q9NRA8
Target Species
Human
Target Name
EIF4ENIF1
Target Full Name
Eukaryotic translation initiation factor 4E transporter
Target Function
EIF4E-binding protein that regulates translation and stability of mRNAs in processing bodies (P-bodies). Plays a key role in P-bodies to coordinate the storage of translationally inactive mRNAs in the cytoplasm and prevent their degradation. Acts as a binding platform for multiple RNA-binding proteins: promotes deadenylation of mRNAs via its interaction with the CCR4-NOT complex, and blocks decapping via interaction with eIF4E (EIF4E and EIF4E2), thereby protecting deadenylated and repressed mRNAs from degradation. Component of a multiprotein complex that sequesters and represses translation of proneurogenic factors during neurogenesis. Promotes miRNA-mediated translational repression. Required for the formation of P-bodies. Involved in mRNA translational repression mediated by the miRNA effector TNRC6B by protecting TNRC6B-targeted mRNAs from decapping and subsequent decay. Also acts as a nucleoplasmic shuttling protein, which mediates the nuclear import of EIF4E and DDX6 by a piggy-back mechanism.
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm. Nucleus. Nucleus, PML body. Nucleus speckle.
Target Tissue Specificity
Widely expressed.
Target Synonyms
2610509L04Rik; 4E T; 4E-T; 4ET; 4ET_HUMAN; A930019J01Rik; AA410001; AU021239; Clast 4; Clast4; D11Ertd166e; eIF4E transporter; Eif4enif1; Eukaryotic translation initiation factor 4E nuclear import factor 1; Eukaryotic translation initiation factor 4E transporter; FLJ21601; FLJ26551; OTTMUSP00000000698; OTTMUSP00000005193; OTTMUSP00000005194; OTTMUSP00000036075
Target Background
The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
