-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELAVL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human ELAVL3 (NP_001411.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ELAVL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human ELAVL3 (NP_001411.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11169A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELAVL3 |
| Target Synonyms | HUC; HUCL; PLE21; ELAVL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse spinal cord, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 161-260 of human ELAVL3 (NP_001411.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFS | Uniprot ID | Q14576 |
Uniprot Id
Q14576
Target Species
Human
Target Name
ELAVL3
Target Full Name
ELAV-like protein 3
Target Function
RNA-binding protein that binds to AU-rich element (ARE) sequences of target mRNAs, including VEGF mRNA. May also bind poly-A tracts via RRM 3. May be involved in neuronal differentiation and maintenance. Plays a role in the stabilization of GAP43 mRNA and in spatial learning.
Target Protein Families
RRM elav family
Target Tissue Specificity
Brain specific.
Target Research Area
Developmental Biology
Target Synonyms
ELAV (embryonic lethal, abnormal vision, Drosophila) like 3 (Hu antigen C); ELAV (embryonic lethal, abnormal vision, Drosophila) like 4 (Hu antigen D); ELAV like 3; ELAV like 4; ELAV like neuron specific RNA binding protein 3; ELAV like neuron specific RNA binding protein 4; ELAV like protein 3; ELAV like protein 4; ELAV-like protein 3; ELAV3_HUMAN; Elavl3; ELAVL4; Hu antigen C; Hu antigen D; Hu-antigen C; HuC; HUCL; HuD; Paraneoplastic cerebellar degeneration-associated antigen; Paraneoplastic encephalomyelitis antigen HuD; Paraneoplastic limbic encephalitis antigen 21; PLE21; PNEM
Target Background
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification