-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ELF4 (NP_001412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against ELF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ELF4 (NP_001412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-02641A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELF4 |
| Target Synonyms | MEF; ELFR; AIFBL2; ELF4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ELF4 (NP_001412.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNGIITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKK | Uniprot ID | Q99607 |
Uniprot Id
Q99607
Target Species
Human
Target Name
ELF4
Target Full Name
ETS-related transcription factor Elf-4
Target Function
Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter. Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T-cells via the Kruppel-like factors KLF4 and KLF2. Controls cell senescence in a p53-dependent manner. Can also promote cellular transformation through inhibition of the p16 pathway.
Target Involvement
A chromosomal aberration involving ELF4 has been found in a case of acute myeloid leukemia (AML). Translocation t(X;21)(q25-26;q22) with ERG.
Target Subcellular Location
Nucleus, PML body. Note=Accumulation into PML nuclear bodies is mediated by PML.
Target Protein Families
ETS family
Target Tissue Specificity
Abundantly expressed in the placenta and in a variety of myeloid leukemia cell lines. Moderate levels of expression in heart, lung, spleen, thymus, peripheral blood lymphocytes, ovary and colon. Lower levels of expression in Jurkat T-cells and other T-cel
Target Synonyms
E74-like factor 4; ELF4; ELF4_HUMAN; ELFR; ETS-related transcription factor Elf-4; ETS-related transcription factor Elf4; MEF; Myeloid Elf-1-like factor; Myeloid Elf1-like factor
Target Background
The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.
Notification