-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 329-428 of human ELK1 (NP_001107595.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against ELK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 329-428 of human ELK1 (NP_001107595.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-13618A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELK1 |
| Target Synonyms | ELK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse brain | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 329-428 of human ELK1 (NP_001107595.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP | Uniprot ID | P19419 |
Uniprot Id
P19419
Target Species
Human
Target Name
ELK1
Target Full Name
ETS domain-containing protein Elk-1
Target Function
Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Lung and testis.
Target Synonyms
ELK 1; Elk1; ELK1 member of ETS oncogene family; ELK1 protein; ELK1; ETS transcription factor; ELK1_HUMAN; ELK2 member of ETS oncogene family; ETS domain containing protein Elk 1; ETS domain containing protein Elk1; ETS domain protein Elk1; ETS domain-containing protein Elk-1; ETS like gene 1; Member of ETS oncogene family; Oncogene Elk1; Tyrosine kinase (ELK1) oncogene
Target Background
This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14.
Notification