-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELMO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-120 of human ELMO2 (NP_877496.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELMO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-120 of human ELMO2 (NP_877496.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06038A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELMO2 |
| Target Synonyms | VMPI; CED12; CED-12; ELMO-2; Ced-12A; ELMO2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-120 of human ELMO2 (NP_877496.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF | Uniprot ID | Q96JJ3 |
Uniprot Id
Q96JJ3
Target Species
Human
Target Name
ELMO2
Target Full Name
Engulfment and cell motility protein 2
Target Function
Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
Target Involvement
Vascular malformation, primary intraosseous (VMOS)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol. Membrane.
Target Tissue Specificity
Widely expressed, with a higher expression in skeletal muscle, kidney and placenta.
Target Synonyms
CED 12; Ced 12 homolog 2; CED 12 homolog A; CED 12A; CED-12; ced-12 homolog 2; CED12; CED12 homolog A; CED12; C. elegans; homolog of; 2; CED12A; ELMO 2; ELMO-2; ELMO2; ELMO2_HUMAN; Engulfment and cell motility 2 (ced 12 homolog; C. elegans); Engulfment and cell motility 2; Engulfment and cell motility gene 2; Engulfment and cell motility protein 2; FLJ11656; hCED 12A; hCED-12A; hCED12A; KIAA1834; OTTHUMP00000031762; PH domain protein CED12A; Protein ced 12 homolog A; Protein ced-12 homolog A
Target Background
The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants.
Notification