Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELMOD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELMOD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02445A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELMOD3 |
| Target Synonyms | LST3; RBED1; RBM29; DFNA81; DFNB88; ELMOD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI | Uniprot ID | Q96FG2 |
Uniprot Id
Q96FG2
Target Species
Human
Target Name
ELMOD3
Target Full Name
ELMO domain-containing protein 3
Target Function
Acts as a GTPase-activating protein (GAP) for ARL2 with low specific activity.
Target Involvement
Deafness, autosomal recessive, 88 (DFNB88)
Target Subcellular Location
Cell projection, stereocilium. Cell projection, kinocilium. Cytoplasm, cytoskeleton.
Target Tissue Specificity
Both isoform 1 and isoform 6 are widely expressed.
Target Synonyms
ELMOD3; RBED1; RBM29; PP4068ELMO domain-containing protein 3; RNA-binding motif and ELMO domain-containing protein 1; RNA-binding motif protein 29; RNA-binding protein 29
Target Background
This gene encodes a member of the engulfment and cell motility family of GTPase-activating proteins that regulate Arf GTPase proteins. Members of this family are defined by a conserved engulfment and cell motility domain. In rat cochlea, the encoded protein is found in stereocilia, kinocilia and cuticular plate of developing hair cells suggesting a function for this protein in cochlear sensory cells. An allelic variant of this family has been associated with autosomal recessive nonsyndromic deafness-88 in humans. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
