-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELOVL6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELOVL6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06405A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELOVL6 |
| Target Synonyms | FAE; LCE; FACE; hELO2; ELOVL6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Mouse liver, Rat liver, SK-BR-3, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLL | Uniprot ID | Q9H5J4 |
Uniprot Id
Q9H5J4
Target Species
Human
Target Name
ELOVL6
Target Full Name
Very long chain fatty acid elongase 6
Target Function
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ELO family, ELOVL6 subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ELOVL6; FACE; LCE; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase ELOVL6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Fatty acid elongase 2; hELO2; Fatty acyl-CoA elongase; Long-chain fatty-acyl elongase; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Target Background
Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation (Moon et al., 2001 [PubMed 11567032]).
Notification