-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EMR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EMR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12864A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EMR1 |
| Target Synonyms | EMR1; TM7LN3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL | Uniprot ID | Q14246 |
Uniprot Id
Q14246
Target Species
Human
Target Name
ADGRE1
Target Full Name
Adhesion G protein-coupled receptor E1
Target Function
Orphan receptor involved in cell adhesion and probably in cell-cell interactions specifically involving cells of the immune system. May play a role in regulatory T-cells (Treg) development.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Target Tissue Specificity
Expression is restricted to eosinophils.
Target Synonyms
ADGRE1; Adhesion G protein coupled receptor E1; Adhesion G protein-coupled receptor E1; AGRE1_HUMAN; Cell surface glycoprotein EMR1; Cell surface glycoprotein F4/80; DD7A5 7; Egf like module containing mucin like hormone receptor like 1; Egf like module containing mucin like hormone receptor like sequence 1; EGF like module receptor 1; EGF TM7; EGF-like module receptor 1; EGF-like module-containing mucin-like hormone receptor-like 1; EGFTM7; EMR 1; EMR1; EMR1 hormone receptor; Gpf480; Ly71; Lymphocyte antigen 71; TM7LN3
Target Background
This gene encodes a protein that has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. The N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification