Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-333 of human EN2 (NP_001418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-333 of human EN2 (NP_001418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06888A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EN2 |
| Target Synonyms | EN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-333 of human EN2 (NP_001418.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE | Uniprot ID | P19622 |
Uniprot Id
P19622
Target Species
Human
Target Name
EN2
Target Full Name
Homeobox protein engrailed-2
Target Involvement
Genetic variations in EN2 may be associated with susceptibility to autism.
Target Subcellular Location
Nucleus.
Target Protein Families
Engrailed homeobox family
Target Synonyms
EN2; Homeobox protein engrailed-2; Homeobox protein en-2; Hu-En-2
Target Background
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
