-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENAH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 412-591 of human ENAH (NP_001008493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ENAH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 412-591 of human ENAH (NP_001008493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10529A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENAH |
| Target Synonyms | ENA; MENA; NDPP1; ENAH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 412-591 of human ENAH (NP_001008493.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA | Uniprot ID | Q8N8S7 |
Uniprot Id
Q8N8S7
Target Species
Human
Target Name
ENAH
Target Full Name
Protein enabled homolog
Target Function
Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. ENAH induces the formation of F-actin rich outgrowths in fibroblasts. Acts synergistically with BAIAP2-alpha and downstream of NTN1 to promote filipodia formation.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, filopodium. Cell junction, synapse. Cell junction, focal adhesion.
Target Protein Families
Ena/VASP family
Target Tissue Specificity
Expressed in myoepithelia of parotid, breast, bronchial glands and sweat glands. Expressed in colon-rectum muscolaris mucosae epithelium, pancreas acinar ductal epithelium, endometrium epithelium, prostate fibromuscolar stroma and placenta vascular media.
Target Synonyms
ENA; Enah; ENAH_HUMAN; MENA; NDPP1; Protein enabled homolog
Target Background
This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3.
Notification