Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Endothelin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-212 of human Endothelin 1 (NP_001946.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Endothelin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-212 of human Endothelin 1 (NP_001946.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12208A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Endothelin 1 |
| Target Synonyms | ET1; QME; PPET1; ARCND3; HDLCQ7; Endothelin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, BxPC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 18-212 of human Endothelin 1 (NP_001946.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW | Uniprot ID | P05305 |
Uniprot Id
P05305
Target Species
Human
Target Name
EDN1
Target Full Name
Endothelin-1
Target Function
Endothelins are endothelium-derived vasoconstrictor peptides. Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells.
Target Involvement
Question mark ears, isolated (QME); Auriculocondylar syndrome 3 (ARCND3)
Target Subcellular Location
Secreted.
Target Protein Families
Endothelin/sarafotoxin family
Target Tissue Specificity
Expressed in lung, placental stem villi vessels and in cultured placental vascular smooth muscle cells.
Target Research Area
Signal Transduction
Target Synonyms
ARCND3; Big endothelin-1; EDN1; EDN1_HUMAN; ET-1; ET1; HDLCQ7; PPET1; Preproendothelin 1; Preproendothelin-1; QME
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
