-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO1 (P06733) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO1 (P06733) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16003A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENO1 |
| Target Synonyms | NNE; PPH; MPB1; ENO1L1; ENO1-IT1; HEL-S-17; ENO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, MCF7, Mouse brain, Mouse spleen, Rat kidney, Rat spleen, RD | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO1 (P06733). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT | Uniprot ID | P06733 |
Uniprot Id
P06733
Target Species
Human
Target Name
ENO1
Target Full Name
Alpha-enolase
Target Function
Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.; MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
Target Subcellular Location
Cytoplasm. Cell membrane. Cytoplasm, myofibril, sarcomere, M line. Note=Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.; [Isoform MBP-1]: Nucleus.
Target Protein Families
Enolase family
Target Tissue Specificity
The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Target Research Area
Metabolism
Target Synonyms
2 phospho D glycerate hydro lyase; 2-phospho-D-glycerate hydro-lyase; Alpha enolase; Alpha enolase like 1; Alpha-enolase; C myc promoter binding protein; C-myc promoter-binding protein; EC 4.2.1.11; eno1; ENO1L1; ENOA_HUMAN; Enolase 1 (alpha); Enolase 1 (alpha) like 1; Enolase 1; Enolase alpha; MBP 1; MBP-1; MBP1; MBPB1; MPB 1; MPB-1; MPB1; MYC promoter binding protein 1; NNE; Non neural enolase; Non-neural enolase; Phosphopyruvate hydratase; Plasminogen binding protein; Plasminogen-binding protein; PPH; Tau crystallin
Target Background
This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.
Notification