Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human ENO2 (NP_001966.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human ENO2 (NP_001966.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12139A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENO2 |
| Target Synonyms | NSE; HEL-S-279; ENO2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, Rat uterus, SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human ENO2 (NP_001966.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE | Uniprot ID | P09104 |
Uniprot Id
P09104
Target Species
Human
Target Name
ENO2
Target Full Name
Gamma-enolase
Target Function
Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
Enolase family
Target Tissue Specificity
The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Target Synonyms
NSE; HEL-S-279; ENO2
Target Background
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
