Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENT2/SLC29A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2/SLC29A2 (Q14542) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against ENT2/SLC29A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2/SLC29A2 (Q14542) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of ENT2/SLC29A2 in paraffin-embedded human esophageal cancer using ENT2/SLC29A2 Rabbit mAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Cat.No | ADA-13413A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENT2/SLC29A2 |
| Target Synonyms | ENT2; DER12; HNP36; ENT2/SLC29A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2/SLC29A2 (Q14542). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL | Uniprot ID | Q14542 |
Uniprot Id
Q14542
Target Species
Human
Target Name
SLC29A2
Target Full Name
Equilibrative nucleoside transporter 2
Target Function
Mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. Very less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein. Note=Localized at the basolateral cell membrane in polarized MDCK cells.
Target Protein Families
SLC29A/ENT transporter (TC 2.A.57) family
Target Tissue Specificity
Expressed in skeletal muscle, liver, lung, placenta, brain, heart, kidney and ovarian tissues.
Target Synonyms
36 kDa; 36 kDa nucleolar protein HNP36; Delayed-early response protein 12; DER12; ei-type; Equilibrative NBMPR-insensitive nucleoside transporter; Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter; Equilibrative nucleoside transporter 2; HNP36; Hydrophobic nucleolar protein; Hydrophobic nucleolar protein; 36 kDa; Nucleoside transporter; S29A2_HUMAN; SLC29A2; solute carrier family 29 (nucleoside transporters); member 29; Solute carrier family 29 member 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
