-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENTPD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human ENTPD4 (NP_001122402.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENTPD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human ENTPD4 (NP_001122402.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENTPD4 |
| Target Synonyms | LAP70; LALP70; LYSAL1; UDPase; NTPDase-4; ENTPD4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Jurkat, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human ENTPD4 (NP_001122402.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYA | Uniprot ID | Q9Y227 |
Uniprot Id
Q9Y227
Target Species
Human
Target Name
ENTPD4
Target Full Name
Ectonucleoside triphosphate diphosphohydrolase 4
Target Function
Catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner, with a preference for pyrimidines. Preferentially hydrolyzes UTP and TTP. AMP, ADP, ATP and UMP are not substrates. Preferentially activated by Ca(2+) over Mg(2+).; Has a broad substrate specificity with the ability of cleaving all nucleotide di- and triphosphates with the exception of adenosine di- and triphosphate (ADP and ATP). Preferentially hydrolyzes CTP, UDP, CDP, GTP and GDP. Can use either Ca(2+) or Mg(2+) equally.
Target Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.; [Isoform 2]: Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
GDA1/CD39 NTPase family
Target Tissue Specificity
Ubiquitous. Highest expression in testis and lowest in bladder.
Target Synonyms
ENTPD4; KIAA0392; LALP70; LYSAL1; Ectonucleoside triphosphate diphosphohydrolase 4; NTPDase 4; Golgi UDPase; Lysosomal apyrase-like protein of 70 kDa; Uridine-diphosphatase; UDPase
Target Background
This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity.
Notification