-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPHA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human EPHA4 (NP_004429.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EPHA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human EPHA4 (NP_004429.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11721A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPHA4 |
| Target Synonyms | EK8; SEK; HEK8; TYRO1; EPHA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human EPHA4 (NP_004429.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIE | Uniprot ID | P54764 |
Uniprot Id
P54764
Target Species
Human
Target Name
EPHA4
Target Full Name
Ephrin type-A receptor 4
Target Function
Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. Plays an important role in the development of the nervous system controlling different steps of axonal guidance including the establishment of the corticospinal projections. May also control the segregation of motor and sensory axons during neuromuscular circuit development. In addition to its role in axonal guidance plays a role in synaptic plasticity. Activated by EFNA1 phosphorylates CDK5 at 'Tyr-15' which in turn phosphorylates NGEF regulating RHOA and dendritic spine morphogenesis. In the nervous system, plays also a role in repair after injury preventing axonal regeneration and in angiogenesis playing a role in central nervous system vascular formation. Additionally, its promiscuity makes it available to participate in a variety of cell-cell signaling regulating for instance the development of the thymic epithelium. During development of the cochlear organ of Corti, regulates pillar cell separation by forming a ternary complex with ADAM10 and CADH1 which facilitates the cleavage of CADH1 by ADAM10 and disruption of adherens junctions.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, postsynaptic density membrane. Early endosome. Cell junction, adherens junction.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Cek 8; CEK8; EK8; eph receptor a4; EPH-like kinase 8; EPHA4; EPHA4_HUMAN; Ephrin type-A receptor 4; HEK 8; hEK8; Receptor protein-tyrosine kinase HEK8; Sek 1; SEK; TYRO 1 protein tyrosine kinase; TYRO1; Tyrosine-protein kinase receptor SEK; Tyrosine-protein kinase TYRO1
Target Background
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification