-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPHA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-190 of human EPHA7 (NP_004431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EPHA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-190 of human EPHA7 (NP_004431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00863A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPHA7 |
| Target Synonyms | EHK3; EK11; EHK-3; HEK11; EPHA7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-190 of human EPHA7 (NP_004431.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVG | Uniprot ID | Q15375 |
Uniprot Id
Q15375
Target Species
Human
Target Name
EPHA7
Target Full Name
Ephrin type-A receptor 7
Target Function
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 AND MAPK3 which are phosphorylated upon activation of EPHA7.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
Cek 11; Developmental kinase 1; EBK; EHK-3; EHK3; EK11; Embryonic brain kinase; EPH homology kinase 3; EPH-like kinase 11; Epha7; EPHA7_HUMAN; Ephrin receptor Eph A7; Ephrin type A receptor 7; Ephrin type-A receptor 7; hEK11; MDK 1; Receptor protein tyrosine kinase HEK 11; Tyrosine protein kinase receptor EHK 3
Target Background
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants.
Notification