-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPHB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 615-729 of human EPHB6 (NP_001267724.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EPHB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 615-729 of human EPHB6 (NP_001267724.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPHB6 |
| Target Synonyms | HEP; EPHB6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse brain, Mouse thymus, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 615-729 of human EPHB6 (NP_001267724.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV | Uniprot ID | O15197 |
Uniprot Id
O15197
Target Species
Human
Target Name
EPHB6
Target Full Name
Ephrin type-B receptor 6
Target Function
Kinase-defective receptor for members of the ephrin-B family. Binds to ephrin-B1 and ephrin-B2. Modulates cell adhesion and migration by exerting both positive and negative effects upon stimulation with ephrin-B2. Inhibits JNK activation, T-cell receptor-induced IL-2 secretion and CD25 expression upon stimulation with ephrin-B2.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Target Tissue Specificity
Expressed in brain. Expressed in non invasive breast carcinoma cell lines (at protein level). Strong expression in brain and pancreas, and weak expression in other tissues, such as heart, placenta, lung, liver, skeletal muscle and kidney. Expressed in bre
Target Synonyms
EPH receptor B6; Ephb6; EPHB6_HUMAN; Ephrin type B receptor 6 precursor; Ephrin type-B receptor 6; HEP; MGC129910; MGC129911; Tyrosine protein kinase defective receptor EPH 6; Tyrosine-protein kinase-defective receptor EPH-6
Target Background
This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.
Notification