Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human EPN1 (NP_037465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human EPN1 (NP_037465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07039A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPN1 |
| Target Synonyms | EPN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse liver, Mouse lung, Rat testis, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human EPN1 (NP_037465.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS | Uniprot ID | Q9Y6I3 |
Uniprot Id
Q9Y6I3
Target Species
Human
Target Name
EPN1
Target Full Name
Epsin-1
Target Function
Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Modifies membrane curvature and facilitates the formation of clathrin-coated invaginations. Regulates receptor-mediated endocytosis.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Membrane, clathrin-coated pit.
Target Protein Families
Epsin family
Target Synonyms
EH domain binding mitotic phosphoprotein; EH domain-binding mitotic phosphoprotein; EPN 1; Epn1; EPN1_HUMAN; EPS 15 interacting protein 1; EPS-15-interacting protein 1; Epsin 1; Epsin-1
Target Background
This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
