-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPPIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-133 of human EPPIN (NP_065131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EPPIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-133 of human EPPIN (NP_065131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04399A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPPIN |
| Target Synonyms | CT71; CT72; WAP7; WFDC7; SPINLW1; dJ461P17.2; EPPIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-133 of human EPPIN (NP_065131.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP | Uniprot ID | O95925 |
Uniprot Id
O95925
Target Species
Human
Target Name
EPPIN
Target Full Name
Eppin
Target Function
Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.
Target Subcellular Location
[Isoform 1]: Secreted. Cell surface. Note=Bound to the surface of testicular and on the head and tail of ejaculate spermatozoa.
Target Tissue Specificity
In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial ce
Target Synonyms
Cancer/testis antigen 71; CT 71; CT71; dJ461P17.2; Epididymal protease inhibitor; EPPI_HUMAN; EPPIN 1; EPPIN 2; EPPIN 3; EPPIN; EPPIN1; EPPIN2; EPPIN3; Protease inhibitor WAP7; Serine peptidase inhibitor like with Kunitz and WAP domains 1 (eppin); Serine peptidase inhibitor like with Kunitz and WAP domains 1; Serine protease inhibitor-like with Kunitz and WAP domains 1; SPINLW 1; WAP 7; WAP four disulfide core domain 7; WAP four disulfide core domain protein 7; WAP four-disulfide core domain protein 7; WAP7; WFDC 7; WFDC7
Target Background
This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. The protein can inhibit human sperm motility and exhibits antimicrobial activity against E. coli, and polymorphisms in this gene are associated with male infertility. Read-through transcription also exists between this gene and the downstream WFDC6 (WAP four-disulfide core domain 6) gene. Two transcript variants encoding different isoforms have been found for this gene.
Notification