Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Epsin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Epsin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14477A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Epsin 1 |
| Target Synonyms | EPN1; Epsin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse liver, Rat liver, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKA | Uniprot ID | Q9Y6I3 |
Uniprot Id
Q9Y6I3
Target Species
Human
Target Name
EPN1
Target Full Name
Epsin-1
Target Function
Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Modifies membrane curvature and facilitates the formation of clathrin-coated invaginations. Regulates receptor-mediated endocytosis.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Membrane, clathrin-coated pit.
Target Protein Families
Epsin family
Target Synonyms
EH domain binding mitotic phosphoprotein; EH domain-binding mitotic phosphoprotein; EPN 1; Epn1; EPN1_HUMAN; EPS 15 interacting protein 1; EPS-15-interacting protein 1; Epsin 1; Epsin-1
Target Background
This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
