-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ErbB4/HER4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1308 of human ErbB4/HER4 (Q15303) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ErbB4/HER4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1308 of human ErbB4/HER4 (Q15303) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13617A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ErbB4/HER4 |
| Target Synonyms | HER4; ALS19; p180erbB4; ErbB4/HER4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1200-1308 of human ErbB4/HER4 (Q15303). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV | Uniprot ID | Q15303 |
Uniprot Id
Q15303
Target Species
Human
Target Name
ERBB4
Target Full Name
Receptor tyrosine-protein kinase erbB-4
Target Function
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation, differentiation, migration and apoptosis. Required for normal cardiac muscle differentiation during embryonic development, and for postnatal cardiomyocyte proliferation. Required for normal development of the embryonic central nervous system, especially for normal neural crest cell migration and normal axon guidance. Required for mammary gland differentiation, induction of milk proteins and lactation. Acts as cell-surface receptor for the neuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family members BTC, EREG and HBEGF. Ligand binding triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Ligand specificity and signaling is modulated by alternative splicing, proteolytic processing, and by the formation of heterodimers with other ERBB family members, thereby creating multiple combinations of intracellular phosphotyrosines that trigger ligand- and context-specific cellular responses. Mediates phosphorylation of SHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1, leading to the activation of phosphatidylinositol 3-kinase and AKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 and isoform JM-B CYT-1 mediate reorganization of the actin cytoskeleton and promote cell migration in response to NRG1. Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosine that mediates interaction with PIK3R1, and hence do not phosphorylate PIK3R1, do not protect cells against apoptosis, and do not promote reorganization of the actin cytoskeleton and cell migration. Proteolytic processing of isoform JM-A CYT-1 and isoform JM-A CYT-2 gives rise to the corresponding soluble intracellular domains (4ICD) that translocate to the nucleus, promote nuclear import of STAT5A, activation of STAT5A, mammary epithelium differentiation, cell proliferation and activation of gene expression. The ERBB4 soluble intracellular domains (4ICD) colocalize with STAT5A at the CSN2 promoter to regulate transcription of milk proteins during lactation. The ERBB4 soluble intracellular domains can also translocate to mitochondria and promote apoptosis.
Target Involvement
Amyotrophic lateral sclerosis 19 (ALS19)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=In response to NRG1 treatment, the activated receptor is internalized.; [ERBB4 intracellular domain]: Nucleus. Mitochondrion. Note=Following proteolytical processing E4ICD (E4ICD1 or E4ICD2 generated from the respective isoforms) is translocated to the nucleus. Significantly more E4ICD2 than E4ICD1 is found in the nucleus. E4ICD2 colocalizes with YAP1 in the nucleus.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Target Tissue Specificity
Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are e
Target Synonyms
4ICD; ALS19; Avian erythroblastic leukemia viral oncogene homolog 4; Avian erythroblastic leukemia viral v erb b2 oncogene homolog 4; E4ICD; EC 2.7.10.1; Erbb4; ERBB4 intracellular domain; ERBB4_HUMAN; HER 4; HER4; human epidermal growth factor receptor 4; Mer4; MGC138404; Oncogene ERBB4; p180erbB4; Proto-oncogene-like protein c-ErbB-4; Receptor protein tyrosine kinase erbB 4 precursor; Receptor tyrosine protein kinase erbB 4; s80HER4; Tyrosine kinase type cell surface receptor HER4; Tyrosine kinase-type cell surface receptor HER4; v erb a avian erythroblastic leukemia viral oncogene homolog like 4; v erb a erythroblastic leukemia viral oncogene homolog 4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); V-ERB-B2 avian erythroblastic leukemia viral oncogene homolog 4; Verba avian erythroblastic leukemia viral oncogene homolog like 4; Verba erythroblastic leukemia viral oncogene homolog 4; VERBB2
Target Background
This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Notification