Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02343A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERH |
| Target Synonyms | DROER; ERH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-431, A-549, MCF7, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK | Uniprot ID | P84090 |
Uniprot Id
P84090
Target Species
Human
Target Name
ERH
Target Full Name
Enhancer of rudimentary homolog
Target Function
May have a role in the cell cycle.
Target Subcellular Location
Nucleus.
Target Protein Families
E(R) family
Target Tissue Specificity
Expressed in all tissues examined.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DROER; Enhancer of rudimentary homolog (Drosophila); Enhancer of rudimentary homolog; ERH; ERH_HUMAN; FLJ27340; HGNC:3447
Target Background
Enables methyl-CpG binding activity. Predicted to be involved in pyrimidine nucleoside metabolic process. Located in midbody and nucleus. Part of methylosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
