Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERMAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-155 of human ERMAP (NP_061008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERMAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-155 of human ERMAP (NP_061008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01507A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERMAP |
| Target Synonyms | RD; SC; BTN5; PRO2801; ERMAP | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BT-474, K-562, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-155 of human ERMAP (NP_061008.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSA | Uniprot ID | Q96PL5 |
Uniprot Id
Q96PL5
Target Species
Human
Target Name
ERMAP
Target Full Name
Erythroid membrane-associated protein
Target Function
Possible role as a cell-adhesion or receptor molecule of erythroid cells.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm.
Target Protein Families
Immunoglobulin superfamily, BTN/MOG family
Target Tissue Specificity
Expressed in erythroid-enriched bone marrow (at protein level). Highly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen.
Target Synonyms
ERMAP; ERMAP_HUMAN; Erythroblast membrane associated protein ; Erythroid membrane associated protein; Erythroid membrane-associated protein; hERMAP; MGC118810; MGC118811; MGC118812; MGC118813; PRO2801; Radin blood group (Rd); Radin blood group antigen; RD; SC; Scianna blood group (Sc); Scianna blood group antigen
Target Background
The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
