-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERp19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERp19 (NP_056997.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ERp19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERp19 (NP_056997.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13446A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERp19 |
| Target Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; TLP19; hAG-1; PDIA16; hTLP19; ERp19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293T, HT-29, Rat kidney, Rat lung, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERp19 (NP_056997.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEP | Uniprot ID | O95881 |
Uniprot Id
O95881
Target Species
Human
Target Name
TXNDC12
Target Full Name
Thioredoxin domain-containing protein 12
Target Function
Possesses significant protein thiol-disulfide oxidase activity.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
AG1; AGR1; anterior gradient homolog 1; endoplasmic reticulum protein ERp19; Endoplasmic reticulum resident protein 18; Endoplasmic reticulum resident protein 19; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; ER protein 18; ER protein 19; ERP 18; ERP16; ERp18; ERp19; hAG 1; hAG1; hTLP19; PDIA16; protein disulfide isomerase family A, member 16; thioredoxin domain containing 12 (endoplasmic reticulum; Thioredoxin domain-containing protein 12; thioredoxin like protein p19; Thioredoxin-like protein p19; TLP19; TXD12_HUMAN; TXNDC12
Target Background
This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
Notification