-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERp29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ERp29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14258A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERP29 |
| Target Synonyms | ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107; ERp29 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, NIH/3T3, 293T, A-431, HepG2, Mouse brain, Rat kidney, Rat lung, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM | Uniprot ID | P30040 |
Uniprot Id
P30040
Target Species
Human
Target Name
ERP29
Target Full Name
Endoplasmic reticulum resident protein 29
Target Function
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Target Subcellular Location
Endoplasmic reticulum lumen. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Tissue Specificity
Ubiquitous. Mostly expressed in secretory tissues.
Target Research Area
Signal Transduction
Target Synonyms
ERP29; C12orf8; ERP28Endoplasmic reticulum resident protein 29; ERp29; Endoplasmic reticulum resident protein 28; ERp28; Endoplasmic reticulum resident protein 31; ERp31
Target Background
This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification